DPCfam | MC24717
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 401 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Residues in low-complexity regions (%) | 0.85 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.75 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14291 |
| Sequences matching dominant architecture (%) | 0.78 |
| Average overlap percent | 11.53 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005D1CC17 | 4-63 | 60 | KCKFQDSWLSKVIYKDWLVKDEHDIHFARCRACCKSIKLQTMGEAALTSHAGGAGHKAAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P20193-F1 | 296-346 | 81.97 | 91.43 | View in AlphaFoldDB ↗ |