DPCfam | MC247020
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 680 ± 22 aa |
| Residues in low-complexity regions (%) | 4.89 |
| Residues in coiled-coil regions (%) | 0.42 |
| Predicted disordered residues (%) | 25.61 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00048A9E02 | 50-727 | 677 | LLPSNDTRVNLLLLLADRRGAIVRDPNAKAEGVPLALFPWSVMSEKALPPVEPDYAYDRYYGTRCQSNQAGAAAFIAAVLANAHL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HTC5-F1 | 43-733 | 99.85 | 92.69 | View in AlphaFoldDB ↗ |