DPCfam | MC246965
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 214 ± 55 aa |
| Residues in low-complexity regions (%) | 0.82 |
| Residues in coiled-coil regions (%) | 0.14 |
| Predicted disordered residues (%) | 25.19 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00147 |
| Sequences matching dominant architecture (%) | 60.53 |
| Average overlap percent | 24.4 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W2W8G6 | 97-324 | 228 | RSCRDIKGKSGMYQIQPDSYLPAYFTYCDMATNGGGWTLVAAVHENNIKGKCTKGDLWSSDQGYGYSRNTYNGTGNWENINTFGD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O88310-F1 | 39-306 | 99.63 | 98.46 | View in AlphaFoldDB ↗ |