DPCfam | MC246540
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 100 ± 17 aa |
| Residues in low-complexity regions (%) | 7.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.95 |
| Average transmembrane regions | 1.85 |
| Dominant Pfam architecture(s) | PF10261 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 43.99 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0H2TUK1 | 77-188 | 112 | AQSLRAAEAPSYFARKDNLVNVLFVKRGWAWVSAAFVAFVLTHPHHTTNNNNNTTAGGQQQQQQQHVVGSRRLRAVLRWALVTGW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WBL1-F1 | 87-179 | 94.95 | 84.61 | View in AlphaFoldDB ↗ |