DPCfam | MC246360
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 234 ± 28 aa |
| Residues in low-complexity regions (%) | 1.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.41 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF07507 |
| Sequences matching dominant architecture (%) | 96.26 |
| Average overlap percent | 79.17 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A142X140 | 6-255 | 250 | LSPQSVSIVVQGPVVGTPDLPVQERVTQRVLASIRRCFPGAEIVLSTWEGTNLDGLEYDIAQLNSDPGGFSVEGPDGSQFPNNMN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0K0E422-F1 | 38-131 | 32.78 | 34.86 | View in AlphaFoldDB ↗ |