DPCfam | MC245968
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 164 ± 24 aa |
| Residues in low-complexity regions (%) | 5.4 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.05 |
| Average transmembrane regions | 1.03 |
| Dominant Pfam architecture(s) | PF01699- PF16494 |
| Sequences matching dominant architecture (%) | 53.51 |
| Average overlap percent | 56.3 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q6AZ76 | 209-405 | 197 | IFAYTWLYIILSVSSPGVVEVWEGLLTFFFFPICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPASKTEIEMDGKVV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A4UQV6-F1 | 211-388 | 99.39 | 63.29 | View in AlphaFoldDB ↗ |