DPCfam | MC245930
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 301 ± 41 aa |
| Residues in low-complexity regions (%) | 3.33 |
| Residues in coiled-coil regions (%) | 0.26 |
| Predicted disordered residues (%) | 19.05 |
| Average transmembrane regions | 0.92 |
| Dominant Pfam architecture(s) | PF07850 |
| Sequences matching dominant architecture (%) | 85.37 |
| Average overlap percent | 28.62 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000B36D3F3 | 12-381 | 370 | LALAVIGSDAAGEFKILHSPPSLKFLEADQTYESLLKEIFSASLGLSIEEESEWKGLHVIDPFNTPEAVVEVYIDGIASLGIHAG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P81134-F1 | 15-349 | 98.46 | 80.65 | View in AlphaFoldDB ↗ |