DPCfam | MC245836
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 578 ± 77 aa |
| Residues in low-complexity regions (%) | 15.26 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 53.57 |
| Average transmembrane regions | 0.99 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W5CVH9 | 38-696 | 659 | DIFSDEFALEPLEIADGFRPVSPTLGDATPFVPAPQPNGSERQPRNFQPPAATPSETFRRGKGSQSQPFGRGNYLPLRQDARFPR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PR03-F1 | 1-593 | 88.41 | 62.43 | View in AlphaFoldDB ↗ |