DPCfam | MC245733
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 711 |
|---|---|
| Mean domain length (aa) | 506 ± 90 aa |
| Residues in low-complexity regions (%) | 3.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.86 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF10433 |
| Sequences matching dominant architecture (%) | 84.36 |
| Average overlap percent | 72.76 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A151TX67 | 25-408 | 384 | YLSKCVLRGSVVLQVLHANIRSPSSNDVVFGKETSIELVVIDEDGNVRSVCDQPVFGTIKDLAILPWNDKFRARDPQLWGKDLLV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4IC37-F1 | 5-594 | 100.00 | 80.36 | View in AlphaFoldDB ↗ |