DPCfam | MC245317
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 400 ± 75 aa |
| Residues in low-complexity regions (%) | 11.85 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.84 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF05316 |
| Sequences matching dominant architecture (%) | 4.08 |
| Average overlap percent | 68.03 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A141IQE8 | 18-440 | 422 | NTKLGVINNNKYLPAFSSEWKNIIYSFNRNNLRNMGWNTINLNKIIQSYFNLFFKSRIFLGKTKFLYLKRRRNLLKRIFVSDADV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P23351-F1 | 39-508 | 100.00 | 74.56 | View in AlphaFoldDB ↗ |