DPCfam | MC245180
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1861 |
|---|---|
| Mean domain length (aa) | 161 ± 25 aa |
| Residues in low-complexity regions (%) | 9.4 |
| Residues in coiled-coil regions (%) | 5.84 |
| Predicted disordered residues (%) | 34.34 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02465 |
| Sequences matching dominant architecture (%) | 62.21 |
| Average overlap percent | 64.35 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00098ACE10 | 5-168 | 164 | SSLGVGSGLDLSSILDSLTAAQKATLTPISNQQSSFTAKLSAYGTLKSALTTFQTANTALSKADLFSATSSTTAFSATTAGNAIA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P39738-F1 | 4-166 | 96.48 | 94.46 | View in AlphaFoldDB ↗ |