DPCfam | MC244755
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 601 |
|---|---|
| Mean domain length (aa) | 179 ± 24 aa |
| Residues in low-complexity regions (%) | 4.35 |
| Residues in coiled-coil regions (%) | 1.11 |
| Predicted disordered residues (%) | 15.67 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF00441- PF12806 |
| Sequences matching dominant architecture (%) | 49.91 |
| Average overlap percent | 67.46 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0K3C5B5 | 389-563 | 175 | RLLTPVVKAFAAELTTSELPRLMEGLGGQGYMVENQFARLIADANVERIWEGTTSILALDVVRVAAQTKGEAIKEFIAWANQVLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EP27-F1 | 396-575 | 97.65 | 97.40 | View in AlphaFoldDB ↗ |