DPCfam | MC24442
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Residues in low-complexity regions (%) | 2.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.34 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T1JB25 | 2452-2524 | 73 | SILDPFSKILSYAIQNLTLTYQQLLELCHLCNRAFSKERDKLLLTRTVVFELVQSLKFKTNVSDDNLLMLVQF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P42173-F1 | 491-574 | 97.67 | 94.38 | View in AlphaFoldDB ↗ |