DPCfam | MC244294
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 136 ± 20 aa |
| Residues in low-complexity regions (%) | 2.08 |
| Residues in coiled-coil regions (%) | 0.04 |
| Predicted disordered residues (%) | 35.23 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1T4QSM5 | 5-153 | 149 | KINKAMNYLATHTVEIGILGSGGNLGGEEEVTVLKYGTVLEFGSNDGRIAPFGYFRRAINTNKDKISLKVKELVNDILRGELNGR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GT49-F1 | 25-186 | 98.44 | 91.72 | View in AlphaFoldDB ↗ |