DPCfam | MC243770
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 53 ± 7 aa |
| Residues in low-complexity regions (%) | 1.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.21 |
| Average transmembrane regions | 0.97 |
| Dominant Pfam architecture(s) | PF07690 |
| Sequences matching dominant architecture (%) | 63.64 |
| Average overlap percent | 6.22 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E1VZM6 | 21-87 | 67 | TSQALQVQPGRWVSNWTPEDPEFWKRTGSAVASQNLKWSIFAEFLGFSVWQLFAIVVVYLPVAGFSY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P10903-F1 | 14-68 | 98.21 | 95.71 | View in AlphaFoldDB ↗ |