DPCfam | MC24359
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 218 ± 29 aa |
| Residues in low-complexity regions (%) | 6.85 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.14 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C4RQQ0 | 28-291 | 263 | PAHAVPSMTFVTATSAINSDLGKTQLVHCPPGRRILGGGAYVGGGGREVMVDTMKPVSTPTGDYFQVNASVTTRPDHTGFGGDWF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P09748-F1 | 386-443 | 29.44 | 93.37 | View in AlphaFoldDB ↗ |