DPCfam | MC243568
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 124 ± 11 aa |
| Residues in low-complexity regions (%) | 0.53 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.23 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11175 |
| Sequences matching dominant architecture (%) | 98.98 |
| Average overlap percent | 51.33 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A8MAP6 | 127-251 | 125 | FLPMPFEKAIIEVENCSDLDVDHLYYMISYYEGVDISNMGRLHAVWRSENPTTLGNPYLILHASGKGHYMGTVLAMEGLSQANPP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PN95-F1 | 167-301 | 100.00 | 96.96 | View in AlphaFoldDB ↗ |