DPCfam | MC24355
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 127 ± 10 aa |
| Residues in low-complexity regions (%) | 8.84 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.93 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00098E5BA1 | 1-122 | 122 | MKASIKLREDELKPPLLRAKVPISVFNLPFAASIAAGDPSDLSFHIITSFSSLPSLKLSYHPNPNPNPNPSPFTLTLKSGAGRFG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9M2P9-F1 | 1-122 | 95.38 | 87.47 | View in AlphaFoldDB ↗ |