DPCfam | MC243497
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 129 ± 13 aa |
| Residues in low-complexity regions (%) | 4.65 |
| Residues in coiled-coil regions (%) | 0.54 |
| Predicted disordered residues (%) | 5.59 |
| Average transmembrane regions | 0.45 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A165H212 | 775-898 | 124 | NDVAFPAFDQIRKTMQDAMQDLARVFDGSKQFSLGQLLDHFGVDLLRNILGVIRQVFVGLIKFAADFATDMRAAITKSLDIPLLT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2FCH7-F1 | 779-892 | 83.46 | 57.73 | View in AlphaFoldDB ↗ |