DPCfam | MC243491
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 192 ± 34 aa |
| Residues in low-complexity regions (%) | 3.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.5 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05036 |
| Sequences matching dominant architecture (%) | 13.46 |
| Average overlap percent | 33.09 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00082B29D9 | 1987-2257 | 271 | TGGLVYKVQVGAFRNPLPQDHFKEFAPISGEKLNNGITRYMVGYFKKFVPANEAKTEVNGIGYSDAFVVAYCNGVRITIEQALQI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q06320-F1 | 180-251 | 37.50 | 93.26 | View in AlphaFoldDB ↗ |