DPCfam | MC243468
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 81 ± 12 aa |
| Residues in low-complexity regions (%) | 0.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.02 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05711 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 36.39 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S7LG93 | 30-110 | 81 | RMAQDEFSHFYQKIHGYTYCCNTRLRALYDALHTIEAQKVKGDVVECGTARGGSAALMGLTLTSLGSERSLWLYDSFEGIP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9AJU0-F1 | 51-122 | 84.71 | 97.97 | View in AlphaFoldDB ↗ |