DPCfam | MC243304
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Residues in low-complexity regions (%) | 1.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.36 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00583 |
| Sequences matching dominant architecture (%) | 96.67 |
| Average overlap percent | 20.41 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A7ZC86 | 1-72 | 72 | MIKNAQRQDAKICIKLLNLAMEDIAYKLSGYDDPLKSDEILEKFFESETNRLSYKNVYVYKRDDVIIAAMCA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A132Z5G6-F1 | 1-84 | 100.00 | 96.87 | View in AlphaFoldDB ↗ |