DPCfam | MC243248
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Residues in low-complexity regions (%) | 0.81 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.31 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00648 |
| Sequences matching dominant architecture (%) | 80.0 |
| Average overlap percent | 12.7 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F1NBD8 | 139-227 | 89 | PVVVKNETSCDLFSANEHLFCSELMRWIISEICALWKICNEKALSNGASTLFWGPWEHIYPFTKTTKGHMPLYNSYGKYVVKLYW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1QQ89-F1 | 107-192 | 94.95 | 82.64 | View in AlphaFoldDB ↗ |