DPCfam | MC243160
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 571 ± 54 aa |
| Residues in low-complexity regions (%) | 3.15 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 24.12 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E7TVA8 | 726-1347 | 622 | LKPPKKDALWKRMELENKRWSRKAEAHRARVAKARLEAPAKLEAQLETLRDSGFKNPADVSKSQHYLYDRMRNLEGNESSRWSIG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9UUF7-F1 | 279-427 | 24.66 | 83.78 | View in AlphaFoldDB ↗ |