DPCfam | MC24316
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 308 ± 30 aa |
| Residues in low-complexity regions (%) | 5.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.45 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13646 |
| Sequences matching dominant architecture (%) | 10.2 |
| Average overlap percent | 10.43 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F9I1A4 | 53-368 | 316 | LLGRILDPSAGALLASLEEGTSDKQLKKEIRRSLFKLAQKGIGAPLSGAERSLRSEPILRLGPEIEGYLSSVDTAGGRLVWLAKP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P55558-F1 | 275-514 | 78.44 | 93.19 | View in AlphaFoldDB ↗ |