DPCfam | MC243001
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 138 ± 18 aa |
| Residues in low-complexity regions (%) | 8.48 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.35 |
| Average transmembrane regions | 0.62 |
| Dominant Pfam architecture(s) | PF08357 |
| Sequences matching dominant architecture (%) | 93.55 |
| Average overlap percent | 35.59 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00042C595D | 341-469 | 129 | PGLSILLVGSVIVLIVYLAWRLLGSRHRKYENGTKCTDVLPAATSLSPPALKPRKVWIVYSADHPLYVDVVLKFAQFLLTVCGTE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8QHJ9-F1 | 296-427 | 98.51 | 77.49 | View in AlphaFoldDB ↗ |