DPCfam | MC242952
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 116 ± 18 aa |
| Residues in low-complexity regions (%) | 2.77 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.55 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17967 |
| Sequences matching dominant architecture (%) | 80.82 |
| Average overlap percent | 88.4 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007E8E8CE | 1040-1157 | 118 | LNHAYAQWIDRGTIVWNKADNDGKVYALAVAPAGGLSIVDGKLSGDFTSVPLTARPDGLTEKQRQAYPQLWNYGGFAVGATDVKA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6EFE0-F1 | 85-201 | 97.56 | 91.85 | View in AlphaFoldDB ↗ |