DPCfam | MC242829
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 99 ± 9 aa |
| Residues in low-complexity regions (%) | 3.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 53.31 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12510 |
| Sequences matching dominant architecture (%) | 77.55 |
| Average overlap percent | 37.12 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000937FA1E | 5-116 | 112 | IASASVDITAIRDEDLLRKMWHDAQDFGRKREIRAHMYKLREERLKALYAPGDAAPLAPSSPFIMEQHNTSSAKFGLSKTSVTGS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P53814-F1 | 582-669 | 84.47 | 80.47 | View in AlphaFoldDB ↗ |