DPCfam | MC242552
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 165 ± 30 aa |
| Residues in low-complexity regions (%) | 9.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 49.33 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14153 |
| Sequences matching dominant architecture (%) | 90.59 |
| Average overlap percent | 84.88 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V2SIR9 | 4-173 | 170 | KPVTKKPLLFINQPKMKEPLGQMQSSFTFSPEKPVQIPDSTQVEKHPVQKTDERDSVQENKRNRKRISVEEQSLIFDEPVKEVPK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O31622-F1 | 11-227 | 98.91 | 65.93 | View in AlphaFoldDB ↗ |