DPCfam | MC242236
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 105 ± 13 aa |
| Residues in low-complexity regions (%) | 8.42 |
| Residues in coiled-coil regions (%) | 58.73 |
| Predicted disordered residues (%) | 39.53 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00435 |
| Sequences matching dominant architecture (%) | 13.04 |
| Average overlap percent | 69.73 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A060WJ34 | 675-788 | 114 | QEFHETLHSLLLWLAHAESRRYAVDIHHPDTPPGTLLEHRNTLTGLQNELRARQSQVGSLQGLWGQLQPAEEEGVGEESVEAREK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4IBE3-F1 | 556-654 | 91.15 | 75.83 | View in AlphaFoldDB ↗ |