DPCfam | MC242089
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 175 ± 43 aa |
| Residues in low-complexity regions (%) | 1.46 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.21 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00328 |
| Sequences matching dominant architecture (%) | 98.69 |
| Average overlap percent | 38.99 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B7NPM6 | 320-444 | 125 | RLRQLYKLAKVLFDFVTPQEYGIDDDEKLEIGLLTSLPLLREIVMDLEEVQASPDAKSFFYFTKESHIYTLLNCILEGGIQTKIA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1N4A0-F1 | 719-968 | 98.36 | 76.38 | View in AlphaFoldDB ↗ |