DPCfam | MC242015
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 102 ± 11 aa |
| Residues in low-complexity regions (%) | 0.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.09 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03068 |
| Sequences matching dominant architecture (%) | 98.05 |
| Average overlap percent | 33.25 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1L6M1D4 | 355-454 | 100 | GNHDLIPAYENAAKSASFPLGRIITGSHVLTETGAFYDAQQLQAPHLVVKSDWLYVGHIDEFLSFVPAATPRGWKLLCASPRLAR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GWE0-F1 | 319-421 | 98.10 | 96.94 | View in AlphaFoldDB ↗ |