DPCfam | MC241712
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Residues in low-complexity regions (%) | 0.48 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.39 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08787 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 36.48 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A1103E3 | 277-354 | 78 | DGIALGEVFSYRIEVVGNTLTVTVMRDGKPDAVQVVDMSESGYDVGGKYMYFKAGVYNQNNSGDPDDYAQVTFYKLEK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q59478-F1 | 220-303 | 95.35 | 98.71 | View in AlphaFoldDB ↗ |