DPCfam | MC241554
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2081 |
|---|---|
| Mean domain length (aa) | 217 ± 75 aa |
| Residues in low-complexity regions (%) | 2.46 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.03 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00994 |
| Sequences matching dominant architecture (%) | 59.12 |
| Average overlap percent | 86.64 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00040BB9C2 | 1-310 | 310 | MGTELVTGQVQDLHTMYVGRYFKSMGIQLAKVVLLPDCSEDIKRVLNDAIEDKYNIILTLGGLGPTSDDLTRDIISEVTSSPLVW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GUM9-F1 | 54-263 | 100.00 | 94.16 | View in AlphaFoldDB ↗ |