DPCfam | MC241469
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 447 ± 41 aa |
| Residues in low-complexity regions (%) | 4.05 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.75 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF00646 |
| Sequences matching dominant architecture (%) | 4.92 |
| Average overlap percent | 7.99 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A8PBR7 | 5-440 | 436 | DLPEEIWRLIADEIVEATFCKEFPYRLMGVNRAFFNYYLDMVYGEVYWAKLDHDTVWQLERLQNPIIASHVKRLRIHAWFIDYLM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1B0GQY9-F1 | 59-192 | 28.76 | 90.15 | View in AlphaFoldDB ↗ |