DPCfam | MC24134
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 300 ± 40 aa |
| Residues in low-complexity regions (%) | 2.72 |
| Residues in coiled-coil regions (%) | 0.06 |
| Predicted disordered residues (%) | 13.65 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF00415 |
| Sequences matching dominant architecture (%) | 3.37 |
| Average overlap percent | 3.65 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F7E5Y0 | 25-279 | 255 | VEKVKSSGEWKAVHDFYLTTFDSFLQLNAAFKKDANAPFNTTEDSGINAQFVNAVYDALLNTPQDIQKSVLKGIINSLLMEWKGP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8IVU3-F1 | 404-693 | 99.29 | 88.68 | View in AlphaFoldDB ↗ |