DPCfam | MC241255
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 165 ± 24 aa |
| Residues in low-complexity regions (%) | 9.46 |
| Residues in coiled-coil regions (%) | 4.93 |
| Predicted disordered residues (%) | 27.99 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08544 |
| Sequences matching dominant architecture (%) | 89.73 |
| Average overlap percent | 38.23 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1C1C8S9 | 319-447 | 129 | MCDVDCGSETPGMVKKVLQWRKERTDEATLLWNALQQGQEDLCRELRQLAAVEAVDSNFTALRDIILTIRSLVREMSMKSGVPIE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q54CW0-F1 | 307-497 | 100.00 | 93.56 | View in AlphaFoldDB ↗ |