DPCfam | MC240992
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 72 ± 10 aa |
| Residues in low-complexity regions (%) | 2.94 |
| Residues in coiled-coil regions (%) | 30.23 |
| Predicted disordered residues (%) | 49.97 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00769 |
| Sequences matching dominant architecture (%) | 95.94 |
| Average overlap percent | 42.0 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| N6TVQ5 | 544-620 | 76 | LEIEKERVEYLEKSKHLQNQLRELRTEIEVLKVTEKASEYDQLHEEQVKLGENKYSTLKKSKSGSTKSRVAFFEEL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077ZIT0-F1 | 393-465 | 97.33 | 92.86 | View in AlphaFoldDB ↗ |