DPCfam | MC240670
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 69 ± 8 aa |
| Residues in low-complexity regions (%) | 12.97 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.77 |
| Average transmembrane regions | 0.2 |
| Dominant Pfam architecture(s) | PF12787 |
| Sequences matching dominant architecture (%) | 5.83 |
| Average overlap percent | 35.74 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A04A7ED | 183-252 | 70 | LPDSALVPVSVVLAKNAIAQGAVMGGVRIGSKAIPVIGAVAGGATSYYFGSSVVKACREGFSPPVEEWPE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8EYZ5-F1 | 142-211 | 100.00 | 68.91 | View in AlphaFoldDB ↗ |