DPCfam | MC240540
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 11831 |
|---|---|
| Mean domain length (aa) | 67 ± 13 aa |
| Residues in low-complexity regions (%) | 4.34 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 2.83 |
| Average transmembrane regions | 1.52 |
| Dominant Pfam architecture(s) | PF07885 |
| Sequences matching dominant architecture (%) | 66.72 |
| Average overlap percent | 61.87 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M9TMR7 | 498-590 | 93 | AEVWVSIVAALVVTGIMIWLLDRYSPYSAQNNADLYPPHCRKFTLKESFWFALTSFTPQGGGEAPKALSGRTLVAAYWLFVVLML... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9W0J0-F1 | 135-189 | 93.33 | 91.12 | View in AlphaFoldDB ↗ |