DPCfam | MC240461
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 206 ± 30 aa |
| Residues in low-complexity regions (%) | 6.26 |
| Residues in coiled-coil regions (%) | 2.28 |
| Predicted disordered residues (%) | 7.23 |
| Average transmembrane regions | 3.71 |
| Dominant Pfam architecture(s) | PF06454 |
| Sequences matching dominant architecture (%) | 2.44 |
| Average overlap percent | 48.26 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K7FX96 | 22-234 | 213 | KVLLYLGSIFTSLLFLVVNLTCAMLIHGDVPESRLRWTVFVRALVNESLFILCAISLACCMCKLAKMSTANVYLESKGTSVCQAI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8N3F9-F1 | 149-363 | 99.07 | 73.49 | View in AlphaFoldDB ↗ |