DPCfam | MC240274
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 228 ± 27 aa |
| Residues in low-complexity regions (%) | 6.77 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 39.43 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H0Z2S5 | 1-224 | 224 | MVNEKHNGTLLVQLGPKLQARPEKLLRQRRGHDDRPEYLVRWNIVSLEERAAGGSSASSGETEAENISMWMSAEEVCASCPALLG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8IWT3-F1 | 2-250 | 100.00 | 61.91 | View in AlphaFoldDB ↗ |