DPCfam | MC239632
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 152 ± 17 aa |
| Residues in low-complexity regions (%) | 2.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.5 |
| Average transmembrane regions | 0.42 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005D1A251 | 8-173 | 166 | WIIAYLAVILVGLAAVSAVVIYIDPYFHYHGQNQHISYILSKERYQNNGIAKHFQYDAVLVGTSMASNYKTSDIDRLFGTNSIKL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O25527-F1 | 10-170 | 97.47 | 84.32 | View in AlphaFoldDB ↗ |