DPCfam | MC23903
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 183 ± 29 aa |
| Residues in low-complexity regions (%) | 3.05 |
| Residues in coiled-coil regions (%) | 13.07 |
| Predicted disordered residues (%) | 39.13 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10232 |
| Sequences matching dominant architecture (%) | 94.52 |
| Average overlap percent | 87.77 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T1IR38 | 5-212 | 208 | EKILDAVLDNLILRVADLKNSIHTFLLKLEHEHETLTWPTVLDNFLLFSGQMNTLLKIMKNEKTPILRNMITLPLHITQDRDEEL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q96G25-F1 | 8-193 | 98.94 | 89.67 | View in AlphaFoldDB ↗ |