DPCfam | MC238612
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 60 ± 11 aa |
| Residues in low-complexity regions (%) | 13.3 |
| Residues in coiled-coil regions (%) | 72.36 |
| Predicted disordered residues (%) | 55.42 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A060WKV6 | 262-347 | 86 | NRVIELEHARKTESGDLLQQIQALEKQLEKNRRFLDEQAVDREHERDVFQQEILNLEQQLKNSQKQQPGSEQRSREVDQLTQQLR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q28628-F1 | 66-130 | 97.01 | 81.22 | View in AlphaFoldDB ↗ |