DPCfam | MC23839
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 167 ± 20 aa |
| Residues in low-complexity regions (%) | 7.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 53.98 |
| Average transmembrane regions | 0.08 |
| Dominant Pfam architecture(s) | PF15949 |
| Sequences matching dominant architecture (%) | 93.75 |
| Average overlap percent | 81.73 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R4ITT8 | 235-401 | 167 | DNKEYRRSQVIAPKTTTQFNQFLPSRDKQSGYVPAPLRKKRAERNEDSRRSWASPMFTEDDGTFTRLFQKNSDSEGSKSVSDITE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8WWI1-F1 | 634-788 | 96.34 | 68.39 | View in AlphaFoldDB ↗ |