DPCfam | MC238365
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 127 ± 30 aa |
| Residues in low-complexity regions (%) | 8.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 46.42 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12115 |
| Sequences matching dominant architecture (%) | 89.26 |
| Average overlap percent | 94.0 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V5H240 | 6-96 | 90 | MKVVCIVLLFVIAAEAASAKESSIDKAPNGQNKNIQFNFPRYVPKHHAFASRLLRICREYTPETPKTKMMTAKTTYKPRINDLQV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q09416-F1 | 8-103 | 47.26 | 58.55 | View in AlphaFoldDB ↗ |