DPCfam | MC23836
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 106 ± 11 aa |
| Residues in low-complexity regions (%) | 4.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.41 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF10070 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 15.33 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C6J138 | 544-646 | 103 | DRLTIEEKADYVKQALVSMGLTEQFAPLVVFCGHGSRSANNPYAAALDCGACGGASGEFNARVLAKLCNEPEIRNALAARGISIP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q47IK9-F1 | 649-757 | 97.32 | 95.62 | View in AlphaFoldDB ↗ |