DPCfam | MC238341
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1881 |
|---|---|
| Mean domain length (aa) | 2107 ± 545 aa |
| Residues in low-complexity regions (%) | 3.42 |
| Residues in coiled-coil regions (%) | 6.34 |
| Predicted disordered residues (%) | 17.6 |
| Average transmembrane regions | 0.41 |
| Dominant Pfam architecture(s) | PF12774- PF17852- PF12775- PF17857- PF12780- PF12777- PF12781- PF03028- PF18198- PF18199 |
| Sequences matching dominant architecture (%) | 26.39 |
| Average overlap percent | 96.72 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1A9WMF7 | 131-1600 | 1470 | LTRELLEQTAKVVRLLARSQTHVLLVGPAGSRQFDTIYIAATMQQAKVHSLQVNSGNYGLQEFYNDFKLAMQMAALDNQCTCLVV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E7FFM4-F1 | 410-2565 | 99.77 | 80.73 | View in AlphaFoldDB ↗ |