DPCfam | MC237874
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 94 ± 26 aa |
| Residues in low-complexity regions (%) | 7.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 41.39 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T1J3Z7 | 910-991 | 82 | FKNADNIWLSGETGDLSLSSLLGHLESPLKNPITQALGIINEDHPACGKLSSDVDNQLLCMLNENSVDYVAKFADLAAQIAV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q96RY5-F1 | 1066-1247 | 99.09 | 45.08 | View in AlphaFoldDB ↗ |